So heilen Sie den Husten einer stillenden Mutter: Auswurfmittel während der Stillzeit, Sirupe, Tabletten

Beim Stillen (HB) zur Behandlung von Husten, begleitet von einer laufenden Nase und Halsschmerzen, können Sie Volksheilmittel verwenden. Einige Tabletten und Sirupe sind ebenfalls erlaubt. Unter den Expektorantien gelten Medikamente auf der Basis von Ambroxol und Acetylcystein als die sichersten. Husten kann durch Stillen geheilt werden, aber nicht alle Kräuter sind für gestillte Babys unbedenklich.

Wenn ein Husten infolge einer Erkältungskrankheit mit erhöhter Körpertemperatur (oder ohne), verstopfter Nase und allgemeinem Unwohlsein auftritt, sollte seine Behandlung bei stillenden Frauen nach den allgemeinen Grundsätzen für die Behandlung akuter Atemwegsinfektionen (akute Atemwegsinfektionen) erfolgen:

  • Stoppen Sie nicht das Stillen. Die Stillzeit hat keinen Einfluss auf den Behandlungsprozess, vorausgesetzt, sie ist ordnungsgemäß organisiert. Die Zusammensetzung der Muttermilch enthält Interferon, das am dritten Tag der Erkrankung vom Immunsystem der Mutter produziert wird. Dank dieser Substanz wird das Baby nicht durch Muttermilch infiziert, sondern erhält die notwendige Immunität. Am fünften Tag einer Erkältung produziert eine stillende Frau Antikörper, die die Infektion zerstören.
  • Mullbinde dient als Barriere gegen Infektionen des Kindes. Nach zwei Stunden muss es gewechselt werden. Vor dem Füttern muss der Raum gelüftet und die Hände gewaschen werden.
  • Eine Frau sollte täglich viel trinken. Gut geeignete Getränke wie Beerenobstgetränke. Die Wiederherstellung des Wasserhaushalts bei der Krankheit spielt eine wichtige Rolle. Während der Laktation wird auch Wasser benötigt, um eine Laktostase zu vermeiden, die durch hohe Temperaturen und Milchstau verursacht wird. Flüssigkeit spült giftige Substanzen aus, die von Mikroorganismen produziert werden, heilt trockenen Husten und verursacht eine Auswurfseparation.
  • Es ist in jedem Fall notwendig, zum Termin mit dem Therapeuten zu kommen oder ihn ins Haus zu rufen. Der Arzt kann während der Stillzeit unbedenkliche Werkzeuge aufnehmen.

Während der Stillzeit können Sie sich nicht selbst behandeln und die Krankheit nicht ignorieren.

Husten kann ein frühes Symptom einer Lungenentzündung sein. In diesem Fall besteht eine hohe Wahrscheinlichkeit für eine Komplikation in Form einer infektiösen Mastitis.

Eine Entzündung der Lunge ist eine schwere bakterielle Erkrankung, die schwer zu behandeln ist. Währenddessen muss die Laktation abgebrochen werden.

http://lecheniegorla.ru/chem-lechit-kashel-kormyashhej-mame/

Lasolvan mit HB

Lasolvan beim Stillen

Neuerdings kümmert sich Mama mit Sorge um die Gesundheit Ihres Babys. Aber was tun, wenn während der Stillzeit Beschwerden im Körper der Frau auftreten? Es stellt sich vor allem die Frage, was einzunehmen ist und wie sich dies auf die Gesundheit des Neugeborenen auswirkt.

Es gibt eine Vielzahl von Medikamenten für verschiedene Zwecke mit einer Reihe von Einschränkungen und Nebenwirkungen. Betrachten Sie eine Droge wie Lasolvan.

Es wird zur Entzündung der Atemwege verschrieben:

  • Asthma bronchiale
  • Kehlkopfentzündung
  • Lungenentzündung,
  • Tracheitis,
  • fahrengit
  • Bronchitis verschiedener Arten.

Es ist ein Auswurfmittel, das den Auswurf verdünnt und schnell aus den Atemwegen entfernt, ein Mittel. Dieses Medikament wird sowohl Erwachsenen als auch Kindern ab dem ersten Tag der Geburt verschrieben. Die Wissenschaftler, die die Tests durchgeführt haben, beweisen, dass es während des Stillens angewendet werden kann, ohne die Gesundheit des Kindes zu beeinträchtigen. Da die Toxizität des Arzneimittels sehr gering ist und in sehr geringen Mengen in die Muttermilch gelangt. Sie sollten das Arzneimittel jedoch nicht im ersten Trimenon der Schwangerschaft einnehmen, da die Wirkung des Arzneimittels auf den Fötus nicht ausreichend untersucht wurde.

Also, Lasolvan freigesetzt in Form von Sirup, Tabletten und Lösung zur Inhalation.

Dosierung:

  • Erwachsene verschreiben das Medikament in Form von Tabletten - dreißig Milligramm dreimal täglich in den ersten zwei oder drei Tagen. Als nächstes reduzieren Sie die Dosierung - 15 Milligramm pro Tag.
  • Der Sirup sollte in ein bis zwei Teelöffel pro Tag eingenommen werden (abhängig von der Art des Sirups und dem prozentualen Anteil von Ambroxolhydrochlorid). Nach dem Essen muss ein Medikament getrunken werden, das bei Raumtemperatur mit Wasser abgespült wird.
  • Die Lösung kann mit jedem modernen Inhalator mit 1: 1-Kochsalzlösung verwendet werden. Sie sollten den Eingriff jedoch nicht öfter als zweimal täglich durchführen.

Pharmakologische Eigenschaften des Arzneimittels

Der Wirkstoff dieses Werkzeugs Ambroxol. Das Medikament kann die folgenden Wirkungen haben, die eine therapeutische Wirkung hervorrufen:

  1. Es wirkt stimulierend auf die Schleimbildung in den Atemwegen. Dies trägt dazu bei, dass die entzündliche Sekretion mit Schleim verbunden ist und beim Husten zusammen entsteht, wodurch das bronchopulmonale System gereinigt wird.
  2. Regt die Bildung von Tensiden an, ohne diese ist die einwandfreie Funktion der Alveolen und damit eine normale Atmung nicht möglich. Wenn es einen Mangel gibt, schreitet der entzündliche Prozess voran, dann tritt Atemnot auf.
  3. Manchmal gibt es eine Schwierigkeit beim Auswurf, weil es eine viskose Konsistenz annimmt. Ambroxol wirkt proteolytisch und verdünnt es.
  4. Erhöht die Aktivität des Epithels der Bronchien, was zur Entfernung von Schleim und zur Beschleunigung der Genesung führt.

Hilfe Somit hat Lasolvan eine schleimlösende und sekretionserzeugende Wirkung.

Darf ich beim Füttern einnehmen?

Die Anwendung von Lazolvan beim Stillen ist nur unter Berücksichtigung der möglichen Risiken für das Kind nach Rücksprache mit einem Spezialisten zulässig, da sein Wirkstoff in die Muttermilch eindringen kann.

Zuverlässige Informationen über die Auswirkungen des Arzneimittels auf Säuglinge während der Fütterung liegen nicht vor, aber langjährige Erfahrungen mit diesem Arzneimittel lassen darauf schließen, dass seine Ernennung zu Müttern, jedoch ausschließlich aus klinischen Gründen, gültig ist.

Die Anwendung von Lasolvan bei Frühgeborenen ist ebenfalls möglich.

Indikationen

Hierbei handelt es sich hauptsächlich um akute und chronische Erkrankungen der Atemwege, die durch die Bildung und Sekretion von viskosem Auswurf gekennzeichnet sind, und zwar:

  • Asthma bronchiale.
  • Akute und chronische Bronchitis.
  • Lungenentzündung virale und bakterielle Ätiologie.
  • Chronisch obstruktive Lungenerkrankung.
  • Bronchiektasie.
  • Erkrankungen der unteren Atemwege mit Auswurfbildung.

Gegenanzeigen

Das Medikament wird nicht für Überempfindlichkeit gegen den Wirkstoff verschrieben. Vorsicht sollte das Medikament für schwangere Frauen in 2-3 Trimester, während der Stillzeit sowie bei Nieren- oder Leberversagen verwendet werden.

Die tägliche Dosis von Lutschtabletten (90 mg) enthält 3200 mg Sorbit. Daher ist Lasolvan in dieser Dosierungsform kontraindiziert, wenn Sie an einer seltenen Fructose-Unverträglichkeit leiden. Es wird auch nicht empfohlen, das Medikament in Form eines Sirups mit dieser Pathologie einzunehmen.

Es ist wichtig! Patienten mit der Unfähigkeit, Lactose, Glucose-Galactose-Malabsorption und Lactasemangel aufzunehmen, sind kontraindiziert.

Nebenwirkungen

Am häufigsten wird Lasolvan von den meisten Patienten ohne Komplikationen toleriert. Während der Behandlung können jedoch Nebenwirkungen auftreten, wie z.

  1. Seitens des Gastrointestinaltraktes kommt es häufig zu Übelkeit, verminderter Empfindlichkeit der Mundhöhle und der Speiseröhre. Selten Durchfall, Sodbrennen, Erbrechen, Schmerzen in der Magengegend, Mundschleimhauttrockenheit.
  2. Seitens des Nervensystems eine Geschmacksverletzung.
  3. Das Immunsystem und die Haut - selten Urtikaria, Hautausschlag, Angioödem, anaphylaktische Reaktionen, Juckreiz und mehr.

Wie wirkt sich die Stillzeit auf das Baby aus?

Das Medikament tritt zusammen mit Muttermilch in relativ geringen Konzentrationen in den Körper des Kindes ein, es gibt keine Hinweise auf eine negative Auswirkung auf das Kind. Es liegen auch keine Daten zu den Auswirkungen auf die Laktation vor. Es kann jedoch argumentiert werden, dass eine anhaltende Erkrankung der Mutter ohne rationale Behandlung sich definitiv nachteilig auf das Kind auswirkt.

Aufgrund der Erfahrung von Experten in den letzten Jahren können wir sagen, dass das Medikament die Laktation und das Baby nicht beeinflusst. Auf dieser Grundlage ist es nicht erforderlich, die Fütterung abzubrechen, da zusammen mit der Milch wichtige Komponenten, die seine Immunität ausmachen, in den Körper eines Neugeborenen gelangen. Es ist jedoch wichtig, die genaue Dosierung und die Empfehlungen des Arztes nicht zu vergessen, da sonst die Gefahr einer Schädigung des Kindes besteht.

In welcher Form darf verwendet werden?

Lasolvan ist in einer Vielzahl unterschiedlicher Darreichungsformen erhältlich. Am häufigsten sind Lutschtabletten, Sirup, Tabletten oder Kapseln gefragt, da diese Formen einfacher einzunehmen sind. Darüber hinaus gibt es:

  • Wässrige oder alkoholische Lösung zur oralen Verabreichung. Natürlich ist die Alkohollösung für schwangere und stillende Frauen strengstens verboten.
  • Lösung zur intravenösen Infusion mit einer Pipette.
  • Inhalationslösung, einschließlich der Verwendung eines Verneblers.
  • Lösliche Brausetabletten.

Weisen Sie Lasolvan in verschiedenen Darreichungsformen zu. Sie wird vom Arzt ausgewählt und hängt vom Einzelfall ab.

Zulassungs- und Dosierungsregeln für HB

Hilfe Innerhalb der Droge wird unabhängig von der Mahlzeit eingenommen. Pastillen müssen langsam im Mund aufgelöst werden, Tabletten werden mit Wasser eingenommen, die Lösung wird mit Saft, Tee, Milch oder Wasser verdünnt.

  1. Tabletten werden 2-3 mal täglich 30 mg verschrieben. Bei einer Abschwächung der Symptome kann die Dosierung reduziert werden.
  2. Lutschtabletten nehmen zwei pro Tag.
  3. Der Sirup wird in den ersten drei Tagen in 10 ml, dann in 5 ml dreimal täglich getrunken.
  4. Inhalationen werden zusammen mit Kochsalzlösung unter Zusatz von 15 mg der Substanz dreimal täglich durchgeführt.
  5. Die intravenöse Verabreichung mit einem Tropfenzähler wird in einem Krankenhaus unter Aufsicht von Ärzten durchgeführt und nicht öfter als dreimal wiederholt. In der Regel reicht jedoch eine Anwendung aus, um den Zustand des Patienten zu lindern.
  6. Die Lösung wird im Falle einer Verschlimmerung der Erkrankung in 4 ml 2-3-mal täglich verschrieben und anschließend die Dosierung schrittweise reduziert.

Die maximale Konzentration von Ambroxol im Blut der Mutter nach der Verabreichung wird 2 Stunden später beobachtet. Diese Tatsache muss berücksichtigt werden. Es wird empfohlen, das Kind unmittelbar nach der Einnahme des Arzneimittels zu füttern. Dann sollte eine Pause von 6-8 Stunden eingelegt werden. So minimaler Schlag der Bestandteile der Droge im Körper des Babys.

Um negative Auswirkungen auf das Kind zu vermeiden, wird davon abgeraten, einen Behandlungskurs von mehr als 5-7 Tagen durchzuführen. Während der Therapie ist es notwendig, den Zustand des Kindes genau zu überwachen, wobei die Verschlechterung seines Zustands oder das Auftreten einer allergischen Reaktion das Medikament sofort abbrechen sollte.

Lasolvan: allgemeine Informationen über das Medikament

Gegenwärtig können Apothekentheken eine große Menge an Hustenmittel vertragen, aber nicht alle von ihnen sind während der Stillzeit erlaubt. Stillen ist eine entscheidende Phase im Leben von Mutter und Kind. Die Annahme von Medikamenten erfordert besondere Sorgfalt, und Selbstmedikation kann schwerwiegende Folgen haben.

Lasolvan ist ein beliebtes Hustenmittel, das die Verdünnung des viskosen Auswurfs fördert und dessen Ausscheidung aus den Atemwegen beschleunigt. Lassen Sie das Werkzeug in Form von Tabletten, Sirup, Injektionslösung und Flüssigkeit für die Durchführung von Inhalationsverfahren los.

Der Hauptvorteil des Arzneimittels ist seine Ungiftigkeit: Es ist nicht abhängig und reichert sich in den inneren Organen an.

Die Lazolvan-Laktation kann in allen Darreichungsformen angewendet werden. In äußerst seltenen Fällen wird jedoch auf Injektionen zurückgegriffen.

Der Wirkstoff des Arzneimittels - Ambroxol - hat folgende Eigenschaften:

  • aktiviert die Schleimbildung;
  • verringert die Viskosität von Sekreten;
  • erleichtert die Extraktion von eitrigem Exsudat;
  • trägt zur Aktivierung des Epithels bei;
  • löscht die Bronchien;
  • hilft, die normale Atmung wiederherzustellen;
  • reduziert Hustenanfälle;
  • beschleunigt den Heilungsprozess.

Bei Einnahme konzentriert sich der Wirkstoff auf den Entzündungsherd - in Lunge und Bronchien. Die Verwendung des Mittels führt zur Aktivität des Epithels, wodurch der Schleim nicht in den Atemwegen stagniert und leicht ausgeschieden wird und die Bakterien mit sich bringt, die die Krankheit verursacht haben.

Angaben zur Ernennung

Lazolvan wird, wenn in irgendeiner Dosierungsform gestillt wird, bei der Behandlung der folgenden Zustände verschrieben, begleitet von trockenem Husten und Auswurf, der schwer zu trennen ist:

  • Bronchitis im akuten Stadium;
  • Bronchiendilatation;
  • chronische Entzündung des Bronchopulmonalsystems;
  • Bronchopneumonie;
  • Asthma.

Um die Symptome einer Erkältung während des Stillens schnell zu beseitigen, sollte die Behandlung so bald wie möglich beginnen. Sie sollten jedoch keine Medikamente selbst verschreiben. Nur ein Arzt kann richtig diagnostizieren.

Die Stillzeit während der Therapie sollte nicht unterbrochen werden: Das Kind erhält zusammen mit der Muttermilch wichtige Antikörper, die seinen Körper schützen.

Ist Lasolvan während der Stillzeit erlaubt?

Vor Beginn der Therapie sollte eine stillende Mutter Ihren Arzt konsultieren. Trotz der relativen Sicherheit der verschriebenen Medikamente besteht weiterhin das Risiko, das Kind zu verletzen. Deshalb ist es notwendig, die genaue Dosierung einzuhalten sowie alle Vorschriften des Arztes einzuhalten.

Die Behandlung eines Hustens mit HB ist problematisch, aber möglich. Wenn die verschriebenen Medikamente die Gesundheit des Kindes nicht gefährden, sollten Sie die Stillzeit nicht abbrechen.

Der Wirkstoff des Arzneimittels ist Ambroxol - ein Derivat von Bromhexin. Die Substanz kann in die Muttermilch eindringen, so dass die Anwendung während des Stillens aufgrund der möglichen Schädigung des Kindes nur aus schwerwiegenden Gründen möglich ist.

Derzeit sind keine genauen Daten zu den Auswirkungen des Arzneimittels auf Neugeborene verfügbar. In der Praxis wird es jedoch häufig zur Beseitigung von Husten bei stillenden Müttern eingesetzt.

Die höchste Konzentration einer Substanz im Kreislaufsystem tritt 2 Stunden nach der Einnahme auf. Diese Eigenschaft sollte bei Frauen während der Stillzeit berücksichtigt werden. Es ist notwendig, das Baby sofort nach der Einnahme des Geldes zu füttern und dann 4-6 Stunden lang nicht zu füttern. Dies hilft, eine übermäßige Aufnahme von Substanzen im Körper des Kindes zu vermeiden. Um das Baby nicht zu infizieren, wird der Mutter empfohlen, eine spezielle Gesichtsmaske zu tragen und diese so oft wie möglich zu wechseln.

Nur der behandelnde Arzt kann die Durchführbarkeit des Arzneimittels in Anbetracht der Risiken für die Gesundheit von Mutter und Kind angemessen beurteilen.

Gegenanzeigen und Nebenwirkungen

Das Medikament ist für die Verwendung in Gegenwart von stillenden Frauen allergische Reaktionen auf Substanzen Ambroxol oder Bromhexin verboten. Es ist auch nicht erlaubt, das Medikament bei der Erkennung von Allergien beim Neugeborenen zu verwenden.

Bei Leber- und Nierenerkrankungen wird Lasolvan mit Vorsicht verschrieben.

Wenn die Anweisungen des Arztes erfüllt sind und die empfohlene Behandlung befolgt wird, provoziert das Medikament in den meisten Fällen keine negativen Reaktionen. In einigen Fällen können bei Frauen Hautallergien in Form von Juckreiz, Hautausschlägen und Schwellungen auftreten. Anaphylaxie und Angioödem werden sehr selten beobachtet.

Während der Behandlung können geringfügige Verstöße gegen den Magen-Darm-Trakt auftreten:

  • Geschmacksveränderung;
  • Übelkeit;
  • würgender Drang.

Das Medikament hat die Fähigkeit, die therapeutische Wirkung anderer Medikamente zu beeinflussen, ihre Konzentration im Kreislaufsystem zu erhöhen und ihre Wirkung zu verstärken.

Nehmen Sie Lasolvan nicht zusammen mit Antitussiva ein, da dies zu Schleimstauungen in den Atemwegen führen kann.

Zusammensetzung, Pharmakokinetik, Art der Anwendung

Der Wirkstoff von Lasolvan ist Ambroxolhydrochlorid. Es ist ein mukolytisches, schnell verdünnendes Sputum, das weniger viskos ist und die inneren Schleimhäute der Bronchien sowie die verlorene Elastizität des Lungengewebes wiederherstellt. Die Zilien des Epithels bewegen sich schneller, der Auswurf stagniert nicht in der Lunge, sondern wird schnell entfernt und trägt Viren und Mikroben mit sich, der Zustand des Patienten wird gelindert. Auf diese Weise verbessert sich die Schleimsekretion, Husten wird produktiv.

Das Medikament wird sehr schnell resorbiert, die maximale Konzentration des Wirkstoffs im Blutplasma wird in 0,5-3 Stunden erreicht. Indikationen zur Anwendung sind neben akuter oder chronischer Bronchitis Lungenentzündung, chronische Lungenobstruktion, Asthma.

Lazolvan wird in Form von Tabletten, süßem Sirup, Injektionslösung und Flüssigkeit zur Inhalation angewendet.
Aufnahmebedingungen für Erwachsene:

  • Tabletten - 30 mg 2-3 mal täglich, die Dosierung wird mit einer Abnahme der Schwere der Symptome verringert;
  • Sirup - 10 ml in den ersten 2-3 Tagen, dann 5 ml 3 mal am Tag;
  • Inhalation - 15-20 mg;
  • Injektionen - 30 mg pro 1 kg Körpergewicht.

Die direkte Kontraindikation für die Aufnahme von Lazolvan ist eine individuelle allergische Reaktion auf Ambroxol und Bromhexidin. Es wird nicht empfohlen, es im ersten Trimester der Schwangerschaft sowie bei bestimmten Erkrankungen der Nieren und der Leber anzuwenden.

Dieses Medikament wird in den meisten Fällen gut vertragen. Es sind nur leichte gastrointestinale Störungen und in Ausnahmefällen allergische Reaktionen möglich.

Pharmakologische Eigenschaften des Arzneimittels

Der Wirkstoff von Lasolvan ist Ambroxol, es ist der aktive Metabolit von Bromhexin. Beide Medikamente sind in Russland unter ähnlichen Namen bekannt und weit verbreitet.

Ambroxol hat die folgende Wirkung, die die therapeutische Eigenschaft von Lazolvan bestimmt:

  • Stimuliert die Schleimbildung in den Alveolen und Bronchien. Dies führt dazu, dass beim Husten eine seröse entzündliche Sekretion auftritt, die sie kontaktiert. So ist die Selbstreinigung des bronchopulmonalen Systems.
  • Ambroxol stimuliert auch die Produktion von Tensiden, ohne die der normale Betrieb der Alveolen (die Hauptelemente des Lungengewebes) und die Atmung unmöglich sind. Mit seinem Mangel schreitet der Entzündungsprozess fort, Atemnot und Schwierigkeiten beim Ein- und Ausatmen.
  • Manchmal wird das Sputum in ausreichenden Mengen in den Bronchien produziert, aber es hat eine viskose Konsistenz, was die Entladung erschwert. Ambroxol wirkt mit proteolytischen Enzymen darauf ein, verflüssigt und erleichtert die Freisetzung.
  • Das Medikament stimuliert auch die Aktivität des Bronchialepithels, um die Schleimsekretion zu entfernen und die Genesung zu beschleunigen. Am Ende führt dies allmählich zu einer Abnahme des Hustens.

Somit hat das Werkzeug eine mukolytische (verdünntes Sputum), schleimlösende und sekreterzeugende Wirkung, die bei vielen Erkrankungen des bronchopulmonalen Systems aktiv eingesetzt werden kann.

Sie können Lasolvan als Inhalation während der Stillzeit sowie in Form von Tabletten, Sirup, im Extremfall als intravenöse Injektion anwenden.

Ist das mit GW möglich?

Ambroxol durchdringt die Blut-Hirn-Schranke (für Gehirnzellen), die Plazenta (für den Fötus in der Gebärmutter) und kommt auch in der Milch während der Stillzeit vor. Daher ist die Anwendung in der Stillzeit nur unter ärztlich verordneten und bedrohlichen Bedingungen und unter Berücksichtigung aller Risiken für das Baby möglich.

Es gibt keine zuverlässigen Daten zur Untersuchung der Wirkung auf Neugeborene. Eine lange Erfahrung in der Anwendung zeigt die Gültigkeit seiner Ernennung für Mütter unter strikter Berücksichtigung der klinischen Indikationen. Die Verwendung dieses Arzneimittels zur Behandlung von Frühgeborenen zeigt seine Sicherheit für diese Altersperiode.

Die maximalen Ambroxolkonzentrationen im Blut werden am Ende von zwei Stunden nach der Verabreichung festgestellt. Frauen während der Stillzeit sollten dies berücksichtigen. Es wird empfohlen, das Baby unmittelbar nach der Einnahme von Lazolvan zu füttern und anschließend eine Pause von 6 bis 8 Stunden einzulegen. So bekommt das Kind die Mindestdosis des Medikaments.

In jedem Fall, ob Lazolvan beim Stillen in einer bestimmten Situation, sollten Sie mit Ihrem Arzt besprechen. Nur er kann das Ausmaß des Aufnahmebedarfs und die Risiken für Mutter und Kind angemessen und richtig einschätzen.

Indikationen zur Verwendung

Lasolvan (Still-Sirup oder andere Formen davon) wird bei der Behandlung der folgenden Erkrankungen wirksam eingesetzt:

  • akute und chronische Bronchitis, begleitet von einem unproduktiven Husten mit einem kleinen viskosen Auswurf;
  • Bronchopneumonie;
  • Bronchialasthma und andere Erkrankungen mit Episoden von Atemwegsobstruktion;
  • als Mukolytikum (um Sputum zu verflüssigen) für pathologische Vergrößerungen der Bronchien.

Sehen Sie sich das Video zum Thema Husten an:

Gegenanzeigen

Lasolvan darf nicht zur Behandlung angewendet werden, wenn jemals allergische Reaktionen auf Ambroxol oder Bromhexin beobachtet wurden.

Es wird nicht empfohlen, das Medikament im ersten Trimenon der Schwangerschaft sowie in anderen Schwangerschaftsabschnitten und während des Stillens zu verwenden - unter Berücksichtigung des Risikos für das Kind.

Nur nach ärztlichen Empfehlungen ist das Medikament bei einer Funktionsstörung der Nieren und der Leber erlaubt.

Nebenwirkungen

Lasolvan verursacht in den meisten Fällen keine negativen Auswirkungen, unter Beachtung der Indikationen und Therapien.

Möglicherweise allergische Reaktionen auf die Haut (Urtikaria, Schwellung, Juckreiz) oder systemische Manifestationen (anaphylaktischer Schock, Angioödem usw.).

Manchmal gibt es auch geringfügige Abweichungen in der Arbeit des Verdauungssystems, nämlich:

  • Geschmackssinn für eine Weile beeinträchtigt
  • Übelkeit und Erbrechen
  • andere dyspeptische Störungen.

Es sollte auch bedacht werden, dass Lasolvan Medikamente beeinflussen kann, während sie eingenommen werden. So erhöht es den Blutspiegel von Amoxicillin, Doxycyclin, Cefuroxim und einigen anderen Medikamenten.

Nehmen Sie Lasolvan nicht zusammen mit hustenhemmenden Arzneimitteln ein, da es bei vermehrter Auswurfbildung stagniert.

Beschreibung Lasolvana

Lasolvan ist ein Medikament, das viskosen Auswurf verdünnt und dessen Entzug beschleunigt. Das Medikament fördert die Selbstreinigung der Atmungsorgane, verhindert den Kollaps des Lungengewebes. Das Medikament verbessert die Bronchial- und Lungenfunktion. Die Wirkung des Arzneimittels wird innerhalb einer halben Stunde nach der Anwendung beobachtet.

Die Zusammensetzung der Darreichungsformen Lasolvana

  • Ambroxol;
  • Gummi arabicum;
  • Sorbit;
  • Pfefferminz- und Eukalyptusöl;
  • Saccharin;
  • flüssiges Paraffin;
  • destilliertes Wasser.
  • Ambroxol;
  • Laktose mit einem daran gebundenen Wassermolekül;
  • Maisstärke;
  • pyrogenes Siliciumdioxid;
  • Stearinsäure.
  • Ambroxol;
  • Konservierungsmittel E210;
  • Hydroxyethylcellulose;
  • Lebensmittelzusatzstoff E950;
  • Glycerin;
  • Aromen von Lebensmitteln;
  • destilliertes Wasser.
  • Ambroxol;
  • Zitronensäure;
  • Natriumhydrogenphosphat;
  • Natriumchlorid;
  • Benzalkoniumchlorid;
  • Wasser

Indikationen für die Verwendung des Arzneimittels:

  • Entzündung der Bronchien und Lungen;
  • Chronische Bronchitis mit Atemwegsobstruktion;
  • Asthma mit schwerem Auswurf;
  • Bronchiektasie.

Befolgen Sie die Dosierung, um die Behandlung effektiv zu gestalten.

Anwendung Lasolvana

Lasolvan-Tabletten für Erwachsene werden in der folgenden Dosierung eingenommen: 30 mg dreimal in 24 Stunden. Waschen Sie eine Tablette mit warmem Wasser ohne Gas (100 ml).

Nehmen Sie Sirup mit Ambroxol-Konzentration - 30 mg pro 10 ml in der folgenden Dosierung:

  • bis zu 3 Jahre - 3 ml zweimal in 24 Stunden;
  • 3 bis 7 Jahre - 3 ml dreimal täglich;
  • von 8 bis 13 Jahren - 5 ml dreimal täglich;
  • von 14 - 10 ml dreimal.

Verwenden Sie Sirup mit Ambroxol-Konzentration - 60 mg pro 10 ml in der folgenden Dosierung:

  • für Patienten von 6 bis 13 Jahren - 3 ml dreimal täglich;
  • ab 14 Jahren - dreimal 5 ml.

Nehmen Sie das Medikament in Form einer Lösung oral wie folgt ein:

  • Patienten unter 3 Jahren - 25 Tropfen zweimal täglich;
  • 4 bis 6 Jahre - 25 Tropfen dreimal;
  • von 7 bis 13 Jahren - 50 Tropfen dreimal in 24 Stunden;
  • Ab 14 Jahren - 100 Tropfen dreimal.

Das Medikament in Wasser verdünnen und zum Zeitpunkt der Einnahme einnehmen.

Verwenden Sie die Lösung zum Einatmen. Wenn der Patient jünger als 7 Jahre ist, beträgt die Dosierung des Arzneimittels 2 ml für den Eingriff zweimal täglich. Wenn der Patient älter als 8 Jahre ist, beträgt die erforderliche Dosis der Lösung 3 ml pro Eingriff, der zweimal durchgeführt wird.

Die Lösung wird nicht für die Verwendung in Verdunstungsinhalatoren empfohlen.

Das Medikament wird durch die intravenöse Methode verabreicht, während die Dosierung - 30 mg / 1 kg Gewicht durch 4 Injektionen geteilt.

Gegenanzeigen

Es ist verboten, Lasolvan mit Überempfindlichkeit gegen die Bestandteile des Arzneimittels und bis zu 12 Wochen nach der Schwangerschaft einzunehmen. Nehmen Sie das Medikament zu einem späteren Zeitpunkt der Schwangerschaft und während des Stillens mit Vorsicht ein. Nehmen Sie das Medikament unter ärztlicher Aufsicht ein, wenn Leber- und Nierenfunktionsstörungen vorliegen.

Es wird nicht empfohlen, das Arzneimittel mit Arzneimitteln zu kombinieren, die die Abgabe von Sputum erschweren.

Manchmal provoziert das Medikament Nebenwirkungen in Form von Sodbrennen, Erbrechen und Magenschmerzen. Allergien sind möglich, die sich in Anaphylaxie, Hautausschlag, Angioödem, Brennnesselfieber und Dermatitis unterschiedlichen Ursprungs äußern.

Inhalation mit Lasolvan während der Schwangerschaft - Anwendung und Gegenanzeigen

Erkältungen gehen oft mit einem starken Husten einher, der den Kranken und ihrer Umgebung viele unangenehme Momente beschert. Husten ist besonders gefährlich für kleine Kinder und schwangere Frauen.

Husten selbst ist nur ein Symptom im Zusammenhang mit der Grunderkrankung. Wenn er jedoch nicht behandelt wird, schreitet die Erkrankung fort und der Zustand des Patienten verschlechtert sich. Für die Behandlung von Husten gibt es viele Medikamente, eines der wirksamsten unter ihnen ist Lasolvan in Form von Sirup zur oralen Verabreichung und Inhalation.

Zusammensetzung und Eigenschaften Lasolvana

Merkmale und Beschreibung des Arzneimittels

Die Basis des Medikaments Lasolvan ist Ambroxolhydrochlorid - eine Substanz, die häufig zur Bekämpfung von trockenem Erstickungshusten eingesetzt wird. Lasolvana hat eine große Anzahl von Duplikaten mit verschiedenen Handelsnamen oder Arzneimitteln mit ähnlicher Wirkung, wobei Ambroxol in seiner Zusammensetzung verwendet wird.

Lasolvan ist besonders wirksam gegen trockenen Husten. Es lindert schnell Anfälle, verdünnt Schleim und erhöht die Sekretion, wodurch aus einem trockenen, unproduktiven Husten ein feuchter, produktiver Husten wird. Diese Wirkung des Arzneimittels beschleunigt die Genesung und bringt dem Patienten eine schnelle Linderung.

Lasolvan ist ein klares Produkt mit einem süßlichen Geschmack. Erhältlich in Form von Sirup, Tropfen und Tabletten sowie in Form einer Injektionslösung.

  • Ambroxolhydrochlorid.
  • Zitronensäuremonohydrat.
  • Natriumhydrophosphatdihydrat.
  • Natriumchlorid.
  • Benzalkoniya chlorid.
  • Das Wasser ist sauber.

Das Inhalieren mit Lasolvan in der Schwangerschaft ist relativ sicher, da es derzeit keine negativen Auswirkungen auf die Schwangerschaft und den Fötus gibt. Es gibt jedoch bestimmte Einschränkungen.

Video zur Inhalation.

Anwendung Lasolvana hat Gegenanzeigen:

  • Erstes Trimester der Schwangerschaft.
  • Stillen
  • Überempfindlichkeit gegen Ambroxol.
  • Allergische Reaktionen

Wie die meisten dieser Medikamente wird Lasolvan an einem dunklen Ort bei einer Temperatur von nicht mehr als 25 ° C aufbewahrt, entfernt von Sonnenlicht und Wärmequellen. Das Werkzeug sollte für kleine Kinder nicht zugänglich sein - sie können süße Sirupe als Leckerbissen nehmen, und die Folgen für die Gesundheit des Babys können sehr gefährlich sein.

Verschreibungspflichtiges Medikament

Anwendungsgebiete Lasolvana

Das Medikament kann zur Behandlung von trockenem Husten bei Erwachsenen und Kindern angewendet werden. 1 ml des Produkts enthält 25 Tropfen Lasolvan.

Sirup und Tropfen können in verschiedenen Flüssigkeiten aufgelöst werden - Wasser, Saft oder Tee. Dies ist besonders wichtig für kleine Kinder, die keine Medikamente trinken, und der Geschmack des Getränks maskiert das Werkzeug.

  • Kinder unter 2 Jahren - 1 ml zweimal täglich.
  • Kinder von 2 bis 6 Jahren - 1 ml dreimal täglich.
  • Kinder von 6 bis 12 Jahren - 2 ml zwei- bis dreimal täglich.
  • Kinder über 12 Jahre und Jugendliche - 4 ml dreimal täglich.

Inhalationen für Kinder bis zu 6 Jahren werden ein- oder zweimal täglich mit 2 ml der Lösung pro Eingriff durchgeführt. Kinder ab 6 Jahren und Erwachsene werden mit der gleichen Häufigkeit inhaliert. Nur das Volumen des Produkts kann auf 3 ml pro Portion erhöht werden.

Zum Einatmen von Lasolvanom keine Dampfinhalatoren verwenden.

Weisen Sie Lasolvan in folgenden Fällen zu:

  • Mit akuter oder chronischer Bronchitis.
  • Während einer Entzündung der Lunge, begleitet von einem starken, hysterischen Husten.
  • Bronchiektasie.
  • Asthma bronchiale (insbesondere, wenn der Auswurf schwer zu trennen ist).
  • Chronisch obstruktive Lungenerkrankung.

Inhalation mit Lasolvan in der Schwangerschaft

Merkmale der Verwendung von Lasolvan, und wie lange

Da derzeit keine genauen Informationen über die Auswirkung von Lasolvan auf den Fötus und die Schwangerschaft vorliegen, ist es falsch, diese Frage eindeutig zu beantworten. Es wird jedoch angenommen, dass die Inhalation mit Lasolvan in der Schwangerschaft nur dann angewendet wird, wenn der erwartete Nutzen aus der Anwendung des Arzneimittels viel höher ist als der theoretisch mögliche Schaden.

Verschreibungspflichtiges Lasolvana während der Schwangerschaft weist bestimmte Einschränkungen auf und kann nur von einem erfahrenen Arzt durchgeführt werden, der das mögliche Risiko von Komplikationen bei der Anwendung des Produkts berücksichtigt.

Jedes Medikament auf Ambroxolbasis, einschließlich Lasolvan, durchdringt leicht die Plazentaschranke. Es dringt schnell in das Blut der Mutter ein und gelangt dann über den allgemeinen Blutkreislauf in das Blutsystem des Fötus. Aus diesem Grund wird angenommen, dass die Anwendung von Lasolvan während des ersten Schwangerschaftstrimesters riskant und ungerechtfertigt ist. Daher wird Lasolvan so gut wie nie angewendet. Zu diesem Zeitpunkt sind alle wichtigen Organe des zukünftigen Kindes gelegt, sodass bereits geringfügige Eingriffe und die geringste Wirkung des Arzneimittels die zukünftige Gesundheit und das Wohlbefinden des Kindes beeinträchtigen können.

Die Anwendung von Lasolvan im zweiten und dritten Trimester ist jedoch ohne Folgen für Mutter und Fötus möglich.

Medikamente während der Schwangerschaft können jedoch eine Bedrohung darstellen. Daher ist die Verwendung von Ambroxol immer die Wahl eines Spezialisten. Dieses Mittel wird nur verschrieben, wenn der Arzt von der Sicherheit der Anwendung dieses Arzneimittels überzeugt ist und der Zustand der Patientin ihre Gesundheit oder den Verlauf der Schwangerschaft gefährden kann (ein hysterischer Husten kann einen spontanen Abbruch hervorrufen). Ambroxol dringt auch leicht in die Muttermilch ein und wird an das Baby weitergegeben. Wenn Sie also die Mutter stillen, sollten Sie dieses Hustenmittel nicht einnehmen.

http://zdorovo.live/beremennost/ambroksol-pri-grudnom-vskarmliviiii-lazolvan.html

Ambroxol während des Stillens

Kann meine Mutter das Medikament "Lasolvan" zum Stillen einnehmen?

Alle Frauen nach der Geburt haben eine verminderte Immunität. Jemand, der für sich selbst und andere unmerklich ist, wird wiederhergestellt, während andere einfach bei ARVI, Bronchitis usw. "hängen bleiben". Die Behandlung wird dadurch beeinflusst, dass Sie sorgfältig Medikamente auswählen müssen, die für das Baby unbedenklich sind.

Lasolvan ist ein wirksames Mittel zur Beseitigung der Symptome einer Bronchitis, mit dem Sie diese Krankheit schnell vergessen können. Erhältlich als Spray, Inhalationslösung, Tabletten und Sirup. Ist es sicher und wirksam Lazolvan beim Stillen?

Pharmakologische Eigenschaften des Arzneimittels

Der Wirkstoff von Lasolvan ist Ambroxol, es ist der aktive Metabolit von Bromhexin. Beide Medikamente sind in Russland unter ähnlichen Namen bekannt und weit verbreitet.

Ambroxol hat die folgende Wirkung, die die therapeutische Eigenschaft von Lazolvan bestimmt:

  • Stimuliert die Schleimbildung in den Alveolen und Bronchien. Dies führt dazu, dass beim Husten eine seröse entzündliche Sekretion auftritt, die sie kontaktiert. So ist die Selbstreinigung des bronchopulmonalen Systems.
  • Ambroxol stimuliert auch die Produktion von Tensiden, ohne die der normale Betrieb der Alveolen (die Hauptelemente des Lungengewebes) und die Atmung unmöglich sind. Mit seinem Mangel schreitet der Entzündungsprozess fort, Atemnot und Schwierigkeiten beim Ein- und Ausatmen.
  • Manchmal wird das Sputum in ausreichenden Mengen in den Bronchien produziert, aber es hat eine viskose Konsistenz, was die Entladung erschwert. Ambroxol wirkt mit proteolytischen Enzymen darauf ein, verflüssigt und erleichtert die Freisetzung.
  • Das Medikament stimuliert auch die Aktivität des Bronchialepithels, um die Schleimsekretion zu entfernen und die Genesung zu beschleunigen. Am Ende führt dies allmählich zu einer Abnahme des Hustens.
Somit hat das Werkzeug eine mukolytische (verdünntes Sputum), schleimlösende und sekreterzeugende Wirkung, die bei vielen Erkrankungen des bronchopulmonalen Systems aktiv eingesetzt werden kann.

Sie können Lasolvan als Inhalation während der Stillzeit sowie in Form von Tabletten, Sirup, im Extremfall als intravenöse Injektion anwenden.

Ist das mit GW möglich?

Ambroxol durchdringt die Blut-Hirn-Schranke (für Gehirnzellen), die Plazenta (für den Fötus in der Gebärmutter) und kommt auch in der Milch während der Stillzeit vor. Daher ist die Anwendung in der Stillzeit nur unter ärztlich verordneten und bedrohlichen Bedingungen und unter Berücksichtigung aller Risiken für das Baby möglich.

Es gibt keine zuverlässigen Daten zur Untersuchung der Wirkung auf Neugeborene. Eine lange Erfahrung in der Anwendung zeigt die Gültigkeit seiner Ernennung für Mütter unter strikter Berücksichtigung der klinischen Indikationen. Die Verwendung dieses Arzneimittels zur Behandlung von Frühgeborenen zeigt seine Sicherheit für diese Altersperiode.

Die maximalen Ambroxolkonzentrationen im Blut werden am Ende von zwei Stunden nach der Verabreichung festgestellt. Frauen während der Stillzeit sollten dies berücksichtigen. Es wird empfohlen, das Baby unmittelbar nach der Einnahme von Lazolvan zu füttern und anschließend eine Pause von 6 bis 8 Stunden einzulegen. So bekommt das Kind die Mindestdosis des Medikaments.

In jedem Fall, ob Lazolvan beim Stillen in einer bestimmten Situation, sollten Sie mit Ihrem Arzt besprechen. Nur er kann das Ausmaß des Aufnahmebedarfs und die Risiken für Mutter und Kind angemessen und richtig einschätzen.

Indikationen zur Verwendung

Lasolvan (Still-Sirup oder andere Formen davon) wird bei der Behandlung der folgenden Erkrankungen wirksam eingesetzt:

  • akute und chronische Bronchitis, begleitet von einem unproduktiven Husten mit einem kleinen viskosen Auswurf;
  • Bronchopneumonie;
  • Bronchialasthma und andere Erkrankungen mit Episoden von Atemwegsobstruktion;
  • als Mukolytikum (um Sputum zu verflüssigen) für pathologische Vergrößerungen der Bronchien.

Sehen Sie sich das Video zum Thema Husten an:

Gegenanzeigen

Lasolvan darf nicht zur Behandlung angewendet werden, wenn jemals allergische Reaktionen auf Ambroxol oder Bromhexin beobachtet wurden.

Es wird nicht empfohlen, das Medikament im ersten Trimenon der Schwangerschaft sowie in anderen Schwangerschaftsabschnitten und während des Stillens zu verwenden - unter Berücksichtigung des Risikos für das Kind.

Nur nach ärztlichen Empfehlungen ist das Medikament bei einer Funktionsstörung der Nieren und der Leber erlaubt.

Nebenwirkungen

Lasolvan verursacht in den meisten Fällen keine negativen Auswirkungen, unter Beachtung der Indikationen und Therapien.

Möglicherweise allergische Reaktionen auf die Haut (Urtikaria, Schwellung, Juckreiz) oder systemische Manifestationen (anaphylaktischer Schock, Angioödem usw.).

Manchmal gibt es auch geringfügige Abweichungen in der Arbeit des Verdauungssystems, nämlich:

  • Geschmackssinn für eine Weile beeinträchtigt
  • Übelkeit und Erbrechen
  • andere dyspeptische Störungen.

Es sollte auch bedacht werden, dass Lasolvan Medikamente beeinflussen kann, während sie eingenommen werden. So erhöht es den Blutspiegel von Amoxicillin, Doxycyclin, Cefuroxim und einigen anderen Medikamenten.

Nehmen Sie Lasolvan nicht zusammen mit hustenhemmenden Arzneimitteln ein, da es bei vermehrter Auswurfbildung stagniert.

Empfehlungen für die Aufnahme

Die Methode und das Schema sollten vom Arzt unter Berücksichtigung des Krankheitsbildes festgelegt werden. Die Standardverwendung lautet wie folgt:

  • Wenn Sie Lasolvan-Tabletten während der Stillzeit einnehmen, müssen Sie 2 bis 3 Mal täglich 30 mg trinken, wobei die Schwere der Symptome und die Dosis verringert werden.
  • Auch zur oralen Verabreichung kann die Lösung zugeordnet werden. In diesem Fall ist es notwendig, es in der akuten Periode der Krankheit in 4 ml 2 - 3 mal pro Tag zu trinken, wobei die Menge allmählich verringert wird.
  • Die Durchschnittsdosis für Sirup beträgt 5 bis 10 ml während des gesamten Behandlungsverlaufs, aber mit der Verbesserung des Zustands ist es auch notwendig, die Menge zu reduzieren.
  • Effektive Anwendung von Lasolvan in Form von Inhalation. Dann benötigen Sie für ein Verfahren für Erwachsene 20 mg Wirkstoff. Die Inhalation sollte 1 - 2 Mal am Tag erfolgen.
  • Falls erforderlich, ist eine intravenöse Verabreichung des Arzneimittels möglich, jedoch nur unter stationären Bedingungen mit einer individuellen Dosisberechnung.

Zusätzlich zur Hauptbehandlung kann Lasolvan Rino während des Stillens zur Bekämpfung von verstopfter Nase und Schnupfen angewendet werden. Es hat einen ähnlichen Namen wie das Medikament, aber einen anderen Wirkstoff und eine andere Wirkung.

Wir empfehlen, einen Artikel über Husten während des Stillens zu lesen. Daraus lernen Sie die Ursachen des Hustens bei stillenden Müttern, Behandlungsmethoden und zugelassene Medikamente kennen.

Lasolvan ist ein wirksames Mittel zur Behandlung von Erkrankungen des bronchopulmonalen Systems, die mit unproduktivem Husten und Schwierigkeiten beim Auswurf von Auswurf einhergehen. Dies ist eines der in Russland als lebenswichtig eingestuften Medikamente (VED).

Es ist möglich, Lasolvan zum Inhalieren während des Stillens sowie in Form von Tabletten oder Sirup zu verwenden. Die Dosis und das Dosierungsschema sollten jedoch zusammen mit dem behandelnden Arzt festgelegt werden, um das Baby maximal vor der Wirkung des Arzneimittels zu schützen.

Ambroxol- Gebrauchsanweisung

Ambroxol ist ein modernes Medikament, das bei entzündlichen Erkrankungen der Atemwege eingesetzt wird, um den Auswurf zu verflüssigen und seine Entfernung aus den Bronchien zu erleichtern. Ambroxol wird auch verwendet, um die Reifung des Lungengewebes bei Frühgeborenen zu stimulieren.

Wie wirkt Ambroxol?

Schleim ist eine Substanz, die in den Atemwegen bei entzündlichen Erkrankungen (ansteckend oder allergisch) gebildet wird. Schleim besteht aus zwei Komponenten: serös und schleimig. Schleim ist eine viskose Komponente, er enthält Proteine ​​und Glykoproteine. Bei einigen Krankheiten hat der Auswurf aufgrund der erhöhten Aktivität der Bronchialschleimhautdrüsen einen überwiegend schleimigen Charakter. Gleichzeitig wird es schwierig, Auswurf zu spucken, und Husten bringt keine Linderung. Ambroxol hat eine proteolytische Wirkung - es spaltet Sputumproteine ​​auf, erleichtert deren Verdünnung, und das Medikament stimuliert die Funktion der Bronchialdrüsen, die den flüssigeren Bestandteil des Sputums produzieren, und „verdünnt“ ihn. Darüber hinaus stimuliert Ambroxol das Flimmerepithel der Bronchien: Spezielle Zilien auf der inneren Oberfläche der Bronchien, die kontinuierlich in Richtung Mund und Nase „schwingen“ und dabei helfen, die Bronchien von Auswurf zu befreien, der Mikroben und Staubpartikel enthält. Langzeitstudien haben die Fähigkeit von Ambroxol bestätigt, die Bildung von Tensiden zu stimulieren - eine spezielle Substanz mit komplexer Struktur, die die Lungenbläschen von innen bedeckt und deren Abfallen verhindert. Diese Eigenschaft von Ambroxol wird zur Behandlung von Lungeninsuffizienz, dem sogenannten Distress-Syndrom bei Frühgeborenen, eingesetzt.

Was passiert, wenn ein Medikament in den Körper gelangt?

Ambroxol ist in Pillen- und Sirupform erhältlich. Bei Einnahme wird der Wirkstoff schnell ins Blut aufgenommen. Ambroxol beginnt 30 Minuten nach der Einnahme und dauert etwa 6-12 Stunden. Die Ausscheidung des Arzneimittels erfolgt über die Nieren, so dass bei chronischem Nierenversagen die Zeit der Ausscheidung von Ambroxol aus dem Körper zunimmt. Ein Teil des Arzneimittels kann in der Muttermilch nachgewiesen werden, diese Konzentration ist jedoch so gering, dass sie den Körper des Kindes beim Stillen nicht beeinträchtigt.

Wann sollte ich Ambroxol einnehmen?

Ambroxol wird in Apotheken ohne ärztliche Verschreibung verkauft. Anwendungsgebiete sind entzündliche Erkrankungen der Atemwege, die unter Bildung von viskosem Auswurf auftreten: chronische Bronchitis und Tracheobronchitis, chronisch obstruktive Lungenerkrankung (COPD), Asthma bronchiale, Bronchiektase, Pneumonie, Mukoviszidose.

Dosierung und Verabreichung

Ambroxol ist in Form von Tabletten zu 30 mg sowie in Form von Sirup in Flaschen zu 100 und 150 ml erhältlich. Tabletten werden im Inneren mit Lebensmitteln verwendet, die mit einer kleinen Menge Flüssigkeit abgespült werden. Kinder über 12 Jahre und Erwachsene nehmen in den ersten 2-3 Tagen 3-mal täglich eine Tablette (30 mg), dann 3-mal täglich eine halbe Tablette (15 mg) oder 2-mal täglich eine Tablette ein. Kinder unter 12 Jahren nehmen 2-3 mal täglich einen halben Tisch ein. Ambroxol in Form eines Sirups ist in einer Konzentration von 15 mg in 5 ml und 30 mg in 5 ml erhältlich. Je nach Konzentration des Wirkstoffs ist die Dosierung also unterschiedlich. Insgesamt nehmen Erwachsene und Kinder über 12 Jahre dreimal täglich 30 mg des Arzneimittels ein. Kinder unter 12 Jahren nehmen dreimal täglich 15 mg ein. Es wird nicht empfohlen, das Medikament länger als 5 Tage ohne ärztliche Aufsicht einzunehmen.

Ambroxol kann Nebenwirkungen verursachen.

Allergische Reaktionen wie Hautausschläge, Urtikaria, Angioödem, Rhinitis (allergische Rhinitis) sind häufiger. In äußerst seltenen Fällen entwickelt sich ein anaphylaktischer Schock. Diese Nebenwirkungen treten auf, wenn der Körper auf eine der Komponenten des Arzneimittels empfindlich reagiert. Selten auftretende Kopfschmerzen, Schwäche, Dysurie (Harnstörungen), Mundtrockenheit, Verstopfung, Durchfall. Bei längerem Gebrauch können Bauchschmerzen, Übelkeit und Erbrechen auftreten. Wenn diese Symptome auftreten, sollten Sie Ihren Arzt konsultieren.

Gegenanzeigen für Ambroxol sind:

Überempfindlichkeit gegen das Medikament oder seine Bestandteile I Trimenon der Schwangerschaft

Das Medikament wird mit Vorsicht bei Kindern unter 6 Jahren während der Stillzeit mit Magengeschwüren, Zwölffingerdarmgeschwüren, Nieren- und Leberversagen angewendet.

Einnahme des Arzneimittels während der Schwangerschaft und Stillzeit

Im ersten Schwangerschaftsdrittel ist das Medikament kontraindiziert. Im zweiten und dritten Trimester müssen die möglichen Vorteile für die Mutter und das potenzielle Risiko für den Fötus bewertet werden. Ambroxol geht jedoch in Konzentrationen in die Muttermilch über, die vermutlich den Körper des Säuglings nicht beeinträchtigen.

Was sind die Symptome und die Behandlung einer Überdosierung?

Ambroxol-Überdosierung ist am häufigsten durch Übelkeit, Erbrechen und Durchfall gekennzeichnet. Im Falle einer Überdosierung sollten Sie einen Arzt aufsuchen. Die Behandlung erfolgt durch Induktion von Erbrechen, Magenspülung, die in den ersten 1-2 Stunden nach Einnahme einer hohen Dosis des Arzneimittels wirksam ist. Darüber hinaus wird die Einnahme von fetthaltigen Produkten empfohlen.

Ambroxol und andere Arzneimittel

Wenn Ambroxol mit anderen Arzneimitteln kombiniert wird, treten keine negativen Auswirkungen auf. Ambroxol in Kombination mit Arzneimitteln, die den Hustenreflex unterdrücken (Codein, Tusuprex, Libexin und andere), wird jedoch nicht empfohlen, da dies zu einer Stagnation großer Mengen von Sputum in der Lunge führen kann (Staunässe der Lunge).

Ambroxol (Lasolvan) Verträglichkeit mit Antibiotika

Behandlung der chronischen Bronchitis zu Hause Wenn eine Person an zwei aufeinanderfolgenden Jahren drei Monate im Jahr Husten hat, deutet dies auf eine chronische Bronchitis hin. Was sind die Symptome einer chronischen Bronchitis, wie verläuft die Erkrankung, welche Konsequenzen und Behandlungsmethoden mit Hausmitteln gibt es - das erfahren Sie aus diesem Artikel. Alles, was Sie über Husten und seine Behandlung wissen müssen. Teil 2

Hustenbehandlung: Hustenmittel und schleimlösende Medikamente

Mit Ausnahme der seltenen Fälle, in denen Husten anfangs als physiologischer Akt betrachtet wird (z. B. beim Würgen), wird dieses Symptom von den meisten Menschen immer als Zeichen einer Krankheit angesehen und darüber hinaus als das eigentliche Wesen der Krankheit. Darauf aufbauend versuchen Menschen (insbesondere Eltern) mit aller Kraft einen Husten zu unterdrücken, da dies ihrer Ansicht nach einer Heilung gleichkommt. Die Realität sieht jedoch völlig anders aus. Der Wunsch, Husten mit allen Mitteln loszuwerden, führt oft zu einer ganzen Reihe von „Hustenbehandlungsversuchen“, die den Zustand des kranken Kindes nicht nur nicht lindern, sondern manchmal sogar verschlimmern...

Ambroxol - vollständige Beschreibung

Ambroxol ist ein modernes Medikament, das bei entzündlichen Erkrankungen der Atemwege eingesetzt wird, um den Auswurf zu verflüssigen und seine Entfernung aus den Bronchien zu erleichtern. Ambroxol wird auch verwendet, um die Reifung des Lungengewebes bei Frühgeborenen zu stimulieren.

Wie behandelt man eine Lungenentzündung?

Die Behandlung der Lungenentzündung (Lungenentzündung) umfasst die Beseitigung des Entzündungszentrums (ätiologische Behandlung) und die Behandlung der Symptome der Lungenentzündung selbst (symptomatische Therapie). Das erste Ziel wird durch die Verschreibung von Antibiotika erreicht (Lungenentzündung ist eine Infektionskrankheit), während das zweite die Behandlung von Fieber, Husten und allgemeiner Krankenpflege vorsieht. In diesem Artikel werden wir über die Grundprinzipien der Behandlung von Lungenentzündung bei Kindern und Erwachsenen sprechen...

Behandlung der chronischen Bronchitis Lasolvan (Ambroxol) Über die Verwendung von Mukolytika wie Lasolvan (Ambroxol) zur Behandlung von Husten und chronischer Bronchitis. Aktuelle Studien belegen, dass die Inzidenz chronischer Bronchitis und chronisch obstruktiver Lungenerkrankungen weiterhin rasant zunimmt. Andererseits kann eine rechtzeitige und gut geplante Behandlung den Krankheitsverlauf erheblich erleichtern und seine Entwicklung verlangsamen. Derzeit ist die Verwendung von Mukolytika (Lasolvan, ACC) die wirksamste und sicherste Richtung bei der Behandlung von chronischer Bronchitis und chronisch obstruktiver Lungenerkrankung... Beschreibung des Arzneimittels Lasolvan (Ambroxol) zur Behandlung von Bronchitis

Pharmakologische Beschreibung des Arzneimittels Lasolvan (Ambroxol)

Daten aus zahlreichen klinischen Studien belegen die hohe Wirksamkeit von Lasolvan (Abroxol) bei der Behandlung der chronischen Bronchitis. Lasolvan (Ambroxol) verdünnt das Sputum, normalisiert das Verhältnis von serösen und schleimigen Bestandteilen des Sputums, aktiviert die Enzyme, die das Sputum zerstören, stimuliert die Bildung von Tensiden (Lungenschmierung) in den Alveolen und Bronchien....

Wie behandelt man Husten?

Muss ich einen Husten behandeln?

Husten, Schnupfen, Fieber, Unwohlsein - das sind die häufigsten Symptome einer Erkältung. Ursachen der Erkältung sind verschiedene Arten von Mikroben (hauptsächlich Viren), die zur Gruppe der Erreger akuter Atemwegserkrankungen (ARI) gehören. Eine weitere häufige Ursache für Husten ist eine (akute oder chronische) Bronchitis, die häufig mit einer Erkältung verwechselt wird. Vor dem Hintergrund einer Erkältung tritt häufig eine Bronchitis auf. Erkrankungen wie Influenza, PC-Infektion, adenovirale Infektion können bei Bronchialverletzungen auftreten und verursachen aus diesem Grund einen Husten. In diesem Fall werden wir darüber sprechen, wie ein Husten richtig und sicher behandelt werden kann...

Wie Husten bei Kindern zu behandeln?

Wie behandelt man einen Husten bei einem Kind?

Husten ist ein häufiges Symptom für verschiedene Atemwegserkrankungen. In diesem Fall weist das Auftreten von Husten fast immer auf eine Niederlage des Kehlkopfes, der Luftröhre oder der Bronchien hin, in denen sich empfindliche Rezeptoren befinden, die den Hustenreflex auslösen. Die Behandlung (in diesem Fall die Beseitigung des Hustens) ist nur dann notwendig, wenn der Husten den Allgemeinzustand des Patienten ernsthaft stört und aus einem Schutzreflex ein Faktor wird, der den Körper schädigen kann...

Lazolvan beim Stillen: Gebrauchsanweisung

Stillende Mütter leiden häufiger an Erkältungen. Immerhin wird ihre Immunität nach der Geburt geschwächt, außerdem wird zu viel Energie für die Milchproduktion aufgewendet. Unter dem Einfluss von Viren treten charakteristische Symptome in Form von Husten, Schwäche, Kopfschmerzen usw. auf.

Lasolvan ist ein beliebtes Mittel zur Behandlung von Erkrankungen der oberen Atemwege. Wie sicher sind Medikamente beim Stillen? Darüber weiter.

Beschreibung Lasolvana

Lasolvan ist ein Medikament, das viskosen Auswurf verdünnt und dessen Entzug beschleunigt. Das Medikament fördert die Selbstreinigung der Atmungsorgane, verhindert den Kollaps des Lungengewebes. Das Medikament verbessert die Bronchial- und Lungenfunktion. Die Wirkung des Arzneimittels wird innerhalb einer halben Stunde nach der Anwendung beobachtet.

Die Zusammensetzung der Darreichungsformen Lasolvana

  • Ambroxol;
  • Gummi arabicum;
  • Sorbit;
  • Pfefferminz- und Eukalyptusöl;
  • Saccharin;
  • flüssiges Paraffin;
  • destilliertes Wasser.
  • Ambroxol;
  • Laktose mit einem daran gebundenen Wassermolekül;
  • Maisstärke;
  • pyrogenes Siliciumdioxid;
  • Stearinsäure.
  • Ambroxol;
  • Konservierungsmittel E210;
  • Hydroxyethylcellulose;
  • Lebensmittelzusatzstoff E950;
  • Glycerin;
  • Aromen von Lebensmitteln;
  • destilliertes Wasser.
  • Ambroxol;
  • Zitronensäure;
  • Natriumhydrogenphosphat;
  • Natriumchlorid;
  • Benzalkoniumchlorid;
  • Wasser

Indikationen für die Verwendung des Arzneimittels:

  • Entzündung der Bronchien und Lungen;
  • Chronische Bronchitis mit Atemwegsobstruktion;
  • Asthma mit schwerem Auswurf;
  • Bronchiektasie.

Befolgen Sie die Dosierung, um die Behandlung effektiv zu gestalten.

Anwendung Lasolvana

Lasolvan-Tabletten für Erwachsene werden in der folgenden Dosierung eingenommen: 30 mg dreimal in 24 Stunden. Waschen Sie eine Tablette mit warmem Wasser ohne Gas (100 ml).

Nehmen Sie Sirup mit Ambroxol-Konzentration - 30 mg pro 10 ml in der folgenden Dosierung:

  • bis zu 3 Jahre - 3 ml zweimal in 24 Stunden;
  • 3 bis 7 Jahre - 3 ml dreimal täglich;
  • von 8 bis 13 Jahren - 5 ml dreimal täglich;
  • von 14 - 10 ml dreimal.

Verwenden Sie Sirup mit Ambroxol-Konzentration - 60 mg pro 10 ml in der folgenden Dosierung:

  • für Patienten von 6 bis 13 Jahren - 3 ml dreimal täglich;
  • ab 14 Jahren - dreimal 5 ml.

Nehmen Sie das Medikament in Form einer Lösung oral wie folgt ein:

  • Patienten unter 3 Jahren - 25 Tropfen zweimal täglich;
  • 4 bis 6 Jahre - 25 Tropfen dreimal;
  • von 7 bis 13 Jahren - 50 Tropfen dreimal in 24 Stunden;
  • Ab 14 Jahren - 100 Tropfen dreimal.

Das Medikament in Wasser verdünnen und zum Zeitpunkt der Einnahme einnehmen.

Verwenden Sie die Lösung zum Einatmen. Wenn der Patient jünger als 7 Jahre ist, beträgt die Dosierung des Arzneimittels 2 ml für den Eingriff zweimal täglich. Wenn der Patient älter als 8 Jahre ist, beträgt die erforderliche Dosis der Lösung 3 ml pro Eingriff, der zweimal durchgeführt wird.

Die Lösung wird nicht für die Verwendung in Verdunstungsinhalatoren empfohlen.

Das Medikament wird durch die intravenöse Methode verabreicht, während die Dosierung - 30 mg / 1 kg Gewicht durch 4 Injektionen geteilt.

Gegenanzeigen

Es ist verboten, Lasolvan mit Überempfindlichkeit gegen die Bestandteile des Arzneimittels und bis zu 12 Wochen nach der Schwangerschaft einzunehmen. Nehmen Sie das Medikament zu einem späteren Zeitpunkt der Schwangerschaft und während des Stillens mit Vorsicht ein. Nehmen Sie das Medikament unter ärztlicher Aufsicht ein, wenn Leber- und Nierenfunktionsstörungen vorliegen.

Es wird nicht empfohlen, das Arzneimittel mit Arzneimitteln zu kombinieren, die die Abgabe von Sputum erschweren.

Manchmal provoziert das Medikament Nebenwirkungen in Form von Sodbrennen, Erbrechen und Magenschmerzen. Allergien sind möglich, die sich in Anaphylaxie, Hautausschlag, Angioödem, Brennnesselfieber und Dermatitis unterschiedlichen Ursprungs äußern.

Lasolvan während der Stillzeit

Um eine Erkältung schnell loszuwerden, beginnen Sie die Behandlung mit dem Einsetzen der ersten Symptome. Gehen Sie sofort ins Krankenhaus, wo der Arzt eine Untersuchung durchführt und ein geeignetes Medikament verschreibt.

Das Stillen eines Kindes mit einer Erkältung mit Husten und Fieber ist nicht erforderlich, da das Baby zusammen mit der Milch nützliche Antikörper erhält, die seinen Körper schützen. Tragen Sie aus Sicherheitsgründen eine spezielle Gesichtsmaske und wechseln Sie die Maske alle 4 bis 5 Stunden.

Lasolvan ist ein wirksames mukolytisches Medikament zur Behandlung von Erkrankungen der oberen Atemwege. Das Medikament darf während des Stillens verwendet werden, jedoch nur nach ärztlicher Verschreibung. Aufgrund der Wirkung der Bestandteile des Arzneimittels wird der Auswurf aus der Lunge beschleunigt und der Husten erleichtert.

Das Medikament wird ins Blut aufgenommen und in die Milch ausgeschieden, daher ist es notwendig, die verschriebene Dosierung einzuhalten. Beobachten Sie nach der Einnahme des Medikaments den Zustand des Neugeborenen. Wenn eine allergische Reaktion auftritt, brechen Sie die Einnahme des Medikaments ab und fragen Sie Ihren Arzt. Und wie Sie sich bei Allergien im Baby helfen können, lesen Sie im Artikel unter dem Link http://vskormi.ru/problems-with-baby/allergiya-u-grudnichka-chto-delat/.

Daher darf Lasolvan nach Anweisung eines Arztes während des Stillens angewendet werden. Beachten Sie genau die Dosierung, die Häufigkeit des Empfangs und erhöhen Sie den Behandlungsverlauf nicht. Selbstbehandlung droht mit gefährlichen Komplikationen!

Ambroxol

Formen der Freisetzung und Verpackung von Ambroxol

Sirup, Tabletten, Oral- und Inhalationslösung

Sirup in Flaschen von 100 ml.

Tabletten in einer Packung mit 10, 20 und 30 Stk.

Lösung zur oralen Verabreichung und Inhalation in Flaschen von 100 ml.

Zusammensetzung und Wirkstoff

Ambroxol enthält:

1 Tablette enthält:

Wirkstoff: Ambroxolhydrochlorid 30 mg

Sonstige Bestandteile: Laktose, Stärke, maisgetrocknete Kieselsäure, kolloidales Magnesiumstearat.

Ambroxol-Lösung zum Verschlucken und Einatmen

2 ml Lösung enthalten:

Wirkstoff: Ambroxolhydrochlorid 15 mg

Sonstige Bestandteile: Zitronensäure-Dinatriumhydrogenphosphat-Natriumdihydrat-Benzalkoniumchlorid-Chlorid-gereinigtes Wasser.

5 ml Sirup enthalten:

Wirkstoff: Ambroxolhydrochlorid 15 mg

Sonstige Bestandteile (Sirup 15 mg / 5 ml): Hydroxyethylcellulosesorbitglycerinsäurebenzopropylenglycolaroma Himbeersäuregereinigter Wein

Sonstige Bestandteile (Sirup 30 mg / 5 ml): Hydroxyethylcellulosesorbitglycerin Saccharin Natriumsalz Benzoesäure Propylenglycol Essenz Orangengeschmack Aprikose Menthol Gereinigtes Wasser

Pharmakologische Wirkung

Ambroxol - sekretomotorny, secretolytic, expectorant.

Stimuliert die serösen Zellen der Schleimhautdrüsen der Bronchien, erhöht den Gehalt an Schleimsekreten und die Freisetzung von Tensiden (Tensid) in den Alveolen und Bronchien normalisiert das gestörte Verhältnis von serösen und schleimigen Bestandteilen des Sputums. Durch die Aktivierung hydrolytischer Enzyme und die Verbesserung der Freisetzung von Lysosomen aus Clara-Zellen wird die Viskosität des Sputums verringert. Erhöht die motorische Aktivität der Zilien des Flimmerepithels, erhöht den mukoziliaren Transport von Auswurf.

Nach Einnahme tritt die Wirkung nach 30 Minuten ein und dauert 6 bis 12 Stunden.

Die Resorption ist hoch, Cmax wird in 2 Stunden (für Tabletten, Sirup), für Lösung zum Einnehmen und Inhalieren erreicht - 0,5–3 Stunden, die Bindung an Plasmaproteine ​​beträgt 80% (für Tabletten, Sirup), für Lösung zum Einnehmen und Inhalationen - 90%. Passiert die Plazentaschranke BBB, die in die Muttermilch übergeht. Die Lösung zum Verschlucken und Einatmen verteilt sich schnell im Gewebe, die höchste Konzentration wird in der Lunge erreicht.

In der Leber metabolisiert, bildet Dibromantranilsäure und Glucuronsäure-Konjugate. Über die Nieren ausgeschieden - 90% in Form von wasserlöslichen Metaboliten, 5% - unverändert. Etwa 30% der Dosis nach oraler Verabreichung werden über den Primärstoffwechsel ausgeschieden. T1 / 2 - 1,3 Stunden, für Lösung zum Einnehmen und Inhalieren - 7–12 Stunden Es gibt keine kumulative Wirkung. Die Eliminationshalbwertszeit erhöht sich mit schwerer chronischer Niereninsuffizienz, ändert sich jedoch nicht mit abnormaler Leberfunktion.

Was hilft Ambroxol: Zeugnis

Akute und chronische Erkrankungen der Atemwege mit Freisetzung von viskosem Auswurf:

  • akute und chronische Bronchitis
  • Lungenentzündung
  • COPD
  • Asthma bronchiale mit Sputumobstruktion
  • Bronchiektasie.

Gegenanzeigen

Überempfindlichkeitsschwangerschaft (ich Trimester).

  • II - III Trimenon der Schwangerschaft
  • Stillzeit
  • Nieren- und / oder Leberversagen.

Ambroxol während der Schwangerschaft und Stillzeit

Präklinische Studien und umfangreiche klinische Erfahrungen haben keine unerwünschten Wirkungen der medikamentösen Behandlung während der Schwangerschaft gezeigt. Sie sollten jedoch die allgemeinen Regeln für die Verschreibung von Arzneimitteln befolgen, insbesondere im ersten Trimester. Lasolvan® geht in die Muttermilch über, wirkt sich jedoch in therapeutischen Dosen nicht nachteilig auf das Baby aus.

Bei der Anwendung von Lasolvana in den II - III Schwangerschaftstrimestern sollten gegebenenfalls die potenzielle Therapie für die Mutter und das mögliche Risiko für den Fötus bewertet werden

Ambroxol: Gebrauchsanweisung

Drinnen drückte er während des Essens Flüssigkeit aus.

Sirup 15 mg / 5 ml: für Erwachsene und Kinder über 12 Jahre - 10 ml (2 Teelöffel) 3-mal täglich für Kinder von 6 bis 12 Jahren - 5 ml (1 Teelöffel) 2 bis 3-mal täglich, 2 –6 Jahre - 3-mal täglich 2,5 ml (1/2 Teelöffel), bis zu 2 Jahre - 2-mal täglich 2,5 ml (1/2 Teelöffel).

Sirup 30 mg / 5 ml: für Erwachsene und Kinder über 12 Jahre - 3-mal täglich 5 ml (1 Teelöffel), für Kinder von 6 bis 12 Jahren - 2,5 ml (1/2 Teelöffel) 2 bis 3 mal am tag.

Die Einnahme des Arzneimittels für mehr als 4–5 Tage ist nur unter ärztlicher Aufsicht möglich.

Drinnen nach dem Essen gepresste Flüssigkeit. Erwachsene - 30 mg (1 Tablette) 3-mal täglich, bei Bedarf kann die Dosis auf 60 mg (2 Tabletten) 2-mal täglich erhöht werden.

Einnahme- und Inhalationslösung

Innen und Inhalation. Drinnen in Form von Tropfen (1 ml = 25 Tropfen), während Sie essen, Tee, Fruchtsaft, Milch oder Wasser hinzufügen. Erwachsene zu Beginn der Behandlung - 4 ml 3-mal täglich, Kinder über 6 Jahre - 2 ml (50 Tropfen) 2-3-mal täglich, Kinder von 2 bis 6 Jahren - 1 ml (25 Tropfen) 3-mal täglich, Kinder unter 2 Jahren - 1 ml (25 Tropfen) 2 mal am Tag.

Inhalation bei Erwachsenen und Kindern über 6 Jahren - 1-2 Inhalationen von 2–3 ml Lösung täglich, bei Kindern unter 6 Jahren - 1-2 Inhalationen von 2 ml Lösung täglich.

Die Inhalationslösung kann mit jedem modernen Inhalationsgerät (außer Dampfinhalatoren) angewendet werden. Das Medikament wird mit Kochsalzlösung gemischt und kann im Verhältnis 1: 1 verdünnt werden, um eine optimale Luftbefeuchtung im Beatmungsgerät zu erreichen. Da bei einer Inhalationstherapie ein tiefer Atemzug Husten hervorrufen kann, sollte die Inhalation bei normaler Atmung durchgeführt werden. Vor dem Einatmen wird normalerweise empfohlen, die Inhalationslösung auf Körpertemperatur zu erwärmen. Patienten mit Asthma bronchiale wird geraten, nach der Einnahme von Bronchodilatatoren zu inhalieren.

Nebenwirkungen

Allergische Reaktionen: Hautausschlag, Urtikaria, Angioödem und in einigen Fällen allergische Kontaktdermatitis. Fälle von akuten schweren anaphylaktischen Reaktionen (anaphylaktischer Schock) wurden äußerst selten gemeldet.

Bei längerer Anwendung in hohen Dosen - Sodbrennen, Gastralgie, Übelkeit, Erbrechen.

Besondere Anweisungen

Patienten, die an Diabetes leiden, können in Form von Sirup verschrieben werden (5 ml Sirup enthalten Sorbit und Saccharin in einer Menge, die 0,18 XE entspricht).

Vertrautheit mit anderen Drogen

Kompatibel mit Medikamenten, die die generische Aktivität hemmen.

Die kombinierte Anwendung mit Hustenmitteln führt vor dem Hintergrund der Hustenreduktion zu Schwierigkeiten beim Auswurf.

Erhöht die Bronchialsekretion von Amoxicillin, Cefuroxim, Erythromycin und Doxycyclin.

Überdosis

Mögliche Symptome: Übelkeit, Erbrechen, Durchfall, Dyspepsie, Gastralgie.

Behandlung: Induktion von Erbrechen, Magenspülung in den ersten 1-2 Stunden nach Einnahme des Arzneimittels, Einnahme von fetthaltigen Produkten, symptomatische Therapie.

Lagerbedingungen und Haltbarkeit

An einem trockenen Ort bei einer Temperatur von nicht mehr als + 25oC lagern.

Analoga und Preise

Unter den ausländischen und russischen Analoga von Ambroxol gibt es:

Ambrobene. Hersteller: Ratiopharm (Deutschland). Preis in Apotheken von 179 Rubel. Flavamed. Hersteller: Berlin-Chemie AG (Deutschland). Preis in Apotheken von 190 Rubel. Lasolvan. Hersteller: Beringer Ingelheim (Österreich). Preis in Apotheken von 281 Rubel. Ambrohexal. Hersteller: Sandoz (Schweiz). Preis in Apotheken ab 99 Rubel.

Halixol. Hersteller: Egis (Ungarn). Preis in Apotheken von 121 Rubel.

Bewertungen

Diese Bewertungen über das Medikament Ambroxol haben wir automatisch im Internet gefunden:

der billigste Sirup (der Rest besteht auch aus Ambroxol, kostet nur 3-4-5 mal teurer).

Unten können Sie Ihre Bewertung abgeben! Hilft Ambroxol bei der Bewältigung der Krankheit?

Ambroxol Tabletten: Anweisungen, Bewertungen, Preis und Analoga

Ambroxol ist ein schleimlösendes Mittel mit starker schleimlösender Wirkung zur Behandlung von Bronchitis und Erkrankungen der oberen Atemwege. Der Wirkstoff des Arzneimittels ist Ambroxolhydrochlorid.

In diesem Artikel werden wir untersuchen, warum Ärzte Ambroxol verschreiben, einschließlich Gebrauchsanweisungen, Analoga und Preisen für dieses Medikament in Apotheken. Echte Bewertungen von Personen, die Ambroxol bereits genutzt haben, können in den Kommentaren nachgelesen werden.

Zusammensetzung und Freigabeform

Ambroxol ist in Form von Tabletten, Langzeittabletten, Brausetabletten, Langzeitkapseln, einem speziell zur Behandlung von Kindern entwickelten Sirup, einer Lösung zum Einnehmen, einer Lösung zum Einnehmen und zum Einatmen erhältlich.

  • Jede Tablette enthält: Wirkstoff - Ambroxolhydrochlorid - 30 mg; Hilfsstoffe - Lactosemonohydrat, Kartoffelstärke, Calciumstearat, wasserfreies kolloidales Siliciumdioxid.

Klinisch-pharmakologische Gruppe: Mukolytikum und Expektorans.

Was hilft Ambroxol?

Indikationen für die Verwendung von Ambroxol sind:

  1. Akute Bronchitis;
  2. Chronische Bronchitis nicht näher bezeichneter Ätiologie;
  3. Asthma bronchiale;
  4. Chronisch obstruktive Lungenerkrankung (COPD);
  5. Bronchiektasie;
  6. Atemnotsyndrom bei Neugeborenen und Frühgeborenen;
  7. Bakterielle Lungenentzündung von nicht näher bezeichneter Ursache;
  8. Akute und chronische Erkrankungen der Atemwege, die die Bildung und Abgabe von Auswurf verletzen.

Pharmakologische Wirkung

Der Wirkstoff von Ambroxol wirkt schleimlösend, sekretomotorisch und sekretolytisch.

Das Medikament stimuliert die Aktivität der serösen Zellen der Bronchialschleimhautdrüsen, was zu einer Erhöhung des Schleimsekretgehalts in den Bronchien und Alveolen führt. Durch die Aktivierung hydrolysierender Enzyme nimmt die Sputumviskosität ab, während die motorische Aktivität des Flimmerepithels zunimmt.

Die Wirkung des Arzneimittels entwickelt sich eine halbe Stunde nach der Verabreichung in jeder Dosierungsform, und die Dauer seiner Wirkung beträgt mindestens 12 Stunden.

Gebrauchsanweisung

Entsprechend der Gebrauchsanweisung werden Ambroxol-Tabletten zu den Mahlzeiten oral verabreicht und mit etwas Wasser abgespült.

  • Erwachsene und Kinder über 12 Jahre sind verschrieben - 30 mg 3-mal täglich. in den ersten 2-3 Tagen, dann 2 mal täglich 30 mg. oder 15 mg (halbe Tablette) 3-mal täglich.
  • Kinder von 6 bis 12 Jahren - 15 mg (halbe Tablette) 2-3 mal täglich.

Es wird nicht empfohlen, länger als 4-5 Tage ohne ärztlichen Termin zu verwenden.

Gegenanzeigen

Tabletten sind bei Kindern unter 6 Jahren kontraindiziert. Ambroxol ist bei Überempfindlichkeit gegen die Bestandteile des Arzneimittels, Phenylketonurie und im ersten Schwangerschaftstrimester kontraindiziert.

Mit Vorsicht wird die Einnahme von Medikamenten während der Stillzeit mit Leber- und Nierenversagen im II- und III-Trimenon der Schwangerschaft sowie bei Zwölffingerdarm- und Magengeschwüren verordnet.

Nebenwirkungen

Ambroxol kann die folgenden Nebenwirkungen verursachen:

  1. Atmungssystem: Rhinorrhoe, trockene Schleimhäute der Atemwege;
  2. Verdauungssystem: Mundtrockenheit, Durchfall, Verstopfung, Übelkeit, Erbrechen, Gastralgie;
  3. Allergien: Hautausschlag, Urtikaria, allergische Kontaktdermatitis, Angioödem, anaphylaktischer Schock;
  4. Andere Nebenwirkungen: Hautausschlag, Dysurie, Kopfschmerzen, Schwäche.

Schwangerschaft und Stillzeit

Das Medikament wird nicht für die Anwendung im ersten Trimenon der Schwangerschaft empfohlen. Wenn Sie Ambroxol in den II-III-Trimestern der Schwangerschaft und während des Stillens benötigen, sollten Sie den potenziellen Nutzen für die Mutter mit einem möglichen Risiko für den Fötus / das Kind abwägen.

Ambroxol-Analoga

Dutzende von Ambroxol-Analoga sind in der Russischen Föderation registriert. Wir werden die gängigsten und qualitativ hochwertigsten Substitute hervorheben:

  • Ambrobene, das Pharmaunternehmen Merkle, Deutschland;
  • Ambrohexal der deutschen Firma Hexal;
  • Lasolvan, ein weiteres deutsches Analogon der Firma Beringer Ingelheim;
  • Flavamed, Produktion Berlin Hemi, Deutschland;
  • Ambroxol Hemofarm, das serbische Pharmaunternehmen Hemofarm und andere.

Achtung: Die Verwendung von Analoga sollte mit dem behandelnden Arzt abgestimmt werden.

Der Durchschnittspreis von AMBROKSOL, Tabletten in Apotheken (Moskau) beträgt 30 Rubel.

Verkaufsbedingungen für Apotheken

Das Medikament ist zur Verwendung als OTC-Mittel zugelassen.

http://mykpoxa.ru/grudnoe_vskarmlivanie/ambroksol_pri_grudnom_vskarmlivanii.html

Weitere Artikel Auf Lung Health